styling

(28 Items)

142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 21.00 21.00 15.75 True True Valid Thru 04/30/24 False False 15.75 False False Diversion contract is required 0 DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Promotional ItemLog in to view pricing!
View Sizes
109721 DEV-12-FF8 DEV-12-FF8 1 FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. DevaCurl DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. True devacurl/devagsflexfactor8oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXFACTOR Curl Protection & Retention Primer is a heat and UV protective spray with the Curl Memory Complex protects from breakage from friction. True Log in to view pricing! False

DevaCurl
FLEXFACTOR Curl Protection & Retention Primer

On SaleLog in to view pricing!
View Sizes
149454 DEV-21-SML23 DEV-21-SML23 1 Curl Essentials Small Intro Kit 39 pc. DevaCurl DevaCurl Curl Essentials Small Intro Kit 39 pc. False devacurl/devacurlcurlessentialssmallintrokit.jpg Bonus Deal Available 715.00 715.00 715.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Curl Essentials Small Intro Kit includes shampoos, conditioners, sprays, gels, towels, and creams. True Log in to view pricing! False

DevaCurl
Curl Essentials Small Intro Kit

39 pc.

SKU DEV-21-SML23

Log in to view pricing!
Quick View
149460 DEV-21-MED23 DEV-21-MED23 1 Curl Pro Medium Intro Kit 103 pc. DevaCurl DevaCurl Curl Pro Medium Intro Kit 103 pc. False devacurl/devacurlcurlpromediumintrokit.jpg Bonus Deal Available 1995.00 1995.00 1995.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Curl Pro Medium Intro Kit includes shampoos, conditioners, sprays, gels, towels, stylers, serums, and creams. True Log in to view pricing! False

DevaCurl
Curl Pro Medium Intro Kit

103 pc.

SKU DEV-21-MED23

Log in to view pricing!
Quick View
149462 DEV-21-LAR23 DEV-21-LAR23 1 Curls 360 Large Intro Kit 179 pc. DevaCurl DevaCurl Curls 360 Large Intro Kit 179 pc. False devacurl/devacurl360largeintro.jpg Bonus Deal Available 2982.00 2982.00 2982.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Curls 360 Large Intro Kit includes shampoos, conditioners, sprays, gels, towels, stylers, serums, mousse, seal, dryer, defuser and creams. True Log in to view pricing! False

DevaCurl
Curls 360 Large Intro Kit

179 pc.

SKU DEV-21-LAR23

Log in to view pricing!
Quick View
109696 DEV-12-DSG8 DEV-12-DSG8 1 DEFINING SPRAY GEL Strong Hold No-Crunch Styler 8 Fl. Oz. DevaCurl DevaCurl DEFINING SPRAY GEL Strong Hold No-Crunch Styler 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsdefiningspraygel8oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEFINING SPRAY GEL Strong Hold No-Crunch Styler previously CURL MAKER, this non-flaking formula with a strong curl-locking blend provides definition to enhance your natural texture. True Log in to view pricing! False

DevaCurl
DEFINING SPRAY GEL Strong Hold No-Crunch Styler

8 Fl. Oz.

SKU DEV-12-DSG8

Log in to view pricing!
Quick View
135792 DEV-05-DFD6 DEV-05-DFD6 1 DEVAFAST DRY Accelerator Spray 6 Fl. Oz. DevaCurl DevaCurl DEVAFAST DRY Accelerator Spray 6 Fl. Oz. False devacurl/devacurldevafastdrydryacceleratorspray6oz.jpg Bonus Deal Available 15.75 15.75 15.75 False False False False 0.00 False False Diversion contract is required 0 Speed up your air-dry & diffusing time up to 66% with Devacurl's DEVAFAST DRY Accelerator Spray! This lightweight dry accelerating spray helps accelerate the rate at which water evaporates from the hair's surface. True Log in to view pricing! False

DevaCurl
DEVAFAST DRY Accelerator Spray

6 Fl. Oz.

SKU DEV-05-DFD6

Log in to view pricing!
Quick View
109682 DEV-12-DF3 DEV-12-DF3 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg Bonus Deal Available 11.55 11.55 11.55 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

3 Fl. Oz.

SKU DEV-12-DF3

Log in to view pricing!
Quick View
109679 DEV-05-FHH10 DEV-05-FHH10 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

10 Fl. Oz.

SKU DEV-05-FHH10

Log in to view pricing!
Quick View
122879 DEV-12-SCR5F DEV-12-SCR5F 1 Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicsupercream51floz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM's hydra-definition blend provides coarse curls with smoothness, shape, shine and frizz control. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic SUPERCREAM

5.1 Fl. Oz.

SKU DEV-12-SCR5F

Log in to view pricing!
Quick View
122877 DEV-12-UDG12F DEV-12-UDG12F 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU DEV-12-UDG12F

Log in to view pricing!
Quick View
148645 DEV-19-SCQ DEV-19-SCQ 1 GET CURLS SUMMER READY 4 pc. DevaCurl DevaCurl GET CURLS SUMMER READY 4 pc. False devacurl/ja23devacurlgetcurlssummerready.jpg Bonus Deal Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's GET CURLS SUMMER READY includes primer, definer, and styler.
Purchase 1 Each:
FLEXFACTOR Curl Protection & Retention Primer 3 oz.
SUPERCREAM Rich Coconut-Infused Definer 3 oz.
ULTRA DEFINING GEL Strong Hold No-Crunch Styler 3 oz.
Receive 1 FREE:
DevaCurl Collapsible Water Bottle 16.9 oz. True Log in to view pricing! False

DevaCurl
GET CURLS SUMMER READY

4 pc.

SKU DEV-19-SCQ

Log in to view pricing!
Quick View
109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Log in to view pricing!
View Sizes
109741 DEV-12-MS8 DEV-12-MS8 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 15.45 15.45 15.45 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

8 Fl. Oz.

SKU DEV-12-MS8

Log in to view pricing!
Quick View
109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Log in to view pricing!
View Sizes