fiber gel

(44 Items)

143407 CUL-12-POSG8 CUL-12-POSG8 1 The Perfect One Spray Gel 8 Fl. Oz. Curlisto Curlisto The Perfect One Spray Gel 8 Fl. Oz. False curlisto/curlistotheperfectone.jpg Bonus Deal Available 14.50 14.50 12.33 True True Valid Thru 04/30/24 False False 12.33 False False Diversion contract is required 0 The Perfect One Spray Gel is a fast-setting, medium-hold gel for all hair types. True Log in to view pricing! False

Curlisto
The Perfect One Spray Gel

8 Fl. Oz.

SKU CUL-12-POSG8

Promotional ItemLog in to view pricing!
Quick View
33462 WEL-12-EPS3 WEL-12-EPS3 1 Dry Pearl Styler Styling Gel 3.5 Fl. Oz. Wella Wella Professionals EIMI Dry Pearl Styler Styling Gel 3.5 Fl. Oz. False wella/wellapropearlstyler.jpg Bonus Deal Available 13.00 13.00 10.40 True False False False 10.40 False False Diversion contract is required 0 Wella Professionals EIMI Dry Pearl Styler Styling Gel creates strong, flexible hold and teasable texture with pearl gloss shine. True Log in to view pricing! False

Wella
Professionals EIMI Dry Pearl Styler Styling Gel

3.5 Fl. Oz.

SKU WEL-12-EPS3

On SaleLog in to view pricing!
Quick View
125657 WEL-12-ESF4 WEL-12-ESF4 1 Sculpt Force Styling Hair Gel 4.58 Fl. Oz. Wella Wella Professionals EIMI Sculpt Force Styling Hair Gel 4.58 Fl. Oz. False wella/wellaprofessionaleimisculptforce4oz.jpg Bonus Deal Available 12.05 12.05 9.64 True False False False 9.64 False False Diversion contract is required 0 Wella Professionals Sculpt Force Styling Hair Gel allows you to get creative with expressive shaping on rock solid styles. False Log in to view pricing! False

Wella
Professionals EIMI Sculpt Force Styling Hair Gel

4.58 Fl. Oz.

SKU WEL-12-ESF4

On SaleLog in to view pricing!
Quick View
42468 WEL-12-ESM5 WEL-12-ESM5 1 Shape Me Gel 5.43 Fl. Oz. Wella Wella Professionals EIMI Shape Me Gel 5.43 Fl. Oz. False wella/wellaeimishapemegel.jpg Bonus Deal Available 13.00 13.00 10.40 True False False False 10.40 False False Diversion contract is required 0 Wella Professionals EIMI Shape Me Gel is a heat-activated hair gel formulated with memorizing polymer complex that helps to shape or blow-dry hair the way you want and keep the look up to 48 hours. True Log in to view pricing! False

Wella
Professionals EIMI Shape Me Gel

5.43 Fl. Oz.

SKU WEL-12-ESM5

On SaleLog in to view pricing!
Quick View
88458 WLS-12-CDG6 WLS-12-CDG6 1 Curl Define Gel 6.08 Fl. Oz. Wellness Premium Products Wellness Premium Products Curl Define Gel 6.08 Fl. Oz. False wellnesspremiumproducts/wellnesscurldefinegel.jpg Bonus Deal Available 16.20 16.20 9.72 True False False False 9.72 False False Diversion contract is required 0 Hydration Collection Curl Defined Gel sculpts, holds, and heals the hair with botanical properties, organic cold-pressed hemp seed oil, and micro-capsule technology. True Log in to view pricing! False

Wellness Premium Products
Curl Define Gel

6.08 Fl. Oz.

SKU WLS-12-CDG6

On SaleLog in to view pricing!
Quick View
63204 ABA-12-FFG6 ABA-12-FFG6 1 Firm Finish Gel 6 Fl. Oz. ABBA® ABBA® pure style Firm Finish Gel 6 Fl. Oz. False abba/abbanewfirmfinishhaorgel8oz236ml.jpg Bonus Deal Available 11.50 11.50 11.50 False False False False 0.00 False False Diversion contract is required 0 ABBA pure style Firm Finish Gel creates a firm yet flexible hold for any style. True Log in to view pricing! False

ABBA®
pure style Firm Finish Gel

6 Fl. Oz.

SKU ABA-12-FFG6

Log in to view pricing!
Quick View
63211 ABA-12-STGE6 ABA-12-STGE6 1 Style Gel Medium Hold 6 Fl. Oz. ABBA® ABBA® pure style Style Gel Medium Hold 6 Fl. Oz. False abba/abbanewstylegelmediumhold6oz177ml.jpg Bonus Deal Available 11.50 11.50 11.50 False False False False 0.00 False False Diversion contract is required 0 ABBA pure style Style Gel Medium Hold creates shape, texture and a medium hold for all hair types. True Log in to view pricing! False

ABBA®
pure style Style Gel Medium Hold

6 Fl. Oz.

SKU ABA-12-STGE6

Log in to view pricing!
Quick View
55480 STS-12-FP3 STS-12-FP3 1 Fiber Paste 3.31 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Fiber Paste 3.31 Fl. Oz. False alfaparfmilano/alfaprfstylestoriesfiberpastepf017569vas100ml331floz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Fiber Paste is a malleable fiber paste which texturizes, separates and defines the strands, without weighing the hair down. Light glossy finish. False Log in to view pricing! False

Alfaparf Milano
Style Stories Fiber Paste

3.31 Fl. Oz.

SKU STS-12-FP3

Log in to view pricing!
Quick View
55477 STS-12-FZG5 STS-12-FZG5 1 Frozen Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Frozen Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparffrozengel53floz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Frozen Gel is a gel for extreme ice-effect looks. Crystallizes and sets the hair style. A perfect look for 8 hours! True Log in to view pricing! False

Alfaparf Milano
Style Stories Frozen Gel

5.3 Fl. Oz.

SKU STS-12-FZG5

Log in to view pricing!
Quick View
55471 STS-12-TG5 STS-12-TG5 1 Texturizing Gel 5.07 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Texturizing Gel 5.07 Fl. Oz. False alfaparfmilano/mj18alfaparftexturizinggel507floz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Texturizing Gel brings structure to the hair fiber, for defined and malleable results with a natural effect. Suitable for all hair types, even to enhance natural drying. True Log in to view pricing! False

Alfaparf Milano
Style Stories Texturizing Gel

5.07 Fl. Oz.

SKU STS-12-TG5

Log in to view pricing!
Quick View
55475 STS-12-WG5 STS-12-WG5 1 Wet Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Wet Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparfwetgel53floz.jpg Bonus Deal Available 13.20 13.20 13.20 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Wet Gel is a gel with a wet effect, for flexible and residue-free results. Perfect look for 8 hours! True Log in to view pricing! False

Alfaparf Milano
Style Stories Wet Gel

5.3 Fl. Oz.

SKU STS-12-WG5

Log in to view pricing!
Quick View
25035 ALX-12-GWAX ALX-12-GWAX 1 Gel Wax 3.4 Fl. Oz. Aloxxi Aloxxi Gel Wax 3.4 Fl. Oz. False aloxxi/aloxxigelwax.jpg Bonus Deal Available 10.80 10.80 10.80 False False False False 0.00 False False Diversion contract is required 0 Define your style with Aloxxi's Gel Wax. This strong hold formula offers the control of a gel with the flexibility of a wax. True Log in to view pricing! False

Aloxxi
Gel Wax

3.4 Fl. Oz.

SKU ALX-12-GWAX

Log in to view pricing!
Quick View
143405 CUL-12-LOG12 CUL-12-LOG12 1 The Light One Styling Gel 12 Fl. Oz. Curlisto Curlisto The Light One Styling Gel 12 Fl. Oz. True curlisto/curlistothelightone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Light One Styling Gel is a lightweight, light hold gel for all hair types. True Log in to view pricing! False

Curlisto
The Light One Styling Gel

Log in to view pricing!
View Sizes
143408 CUL-12-SOG12 CUL-12-SOG12 1 The Strong One Styling Gel 12 Fl. Oz. Curlisto Curlisto The Strong One Styling Gel 12 Fl. Oz. True curlisto/curlistostrongone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Strong One Styling gel is the ultimate definition of curls your way all day. True Log in to view pricing! False

Curlisto
The Strong One Styling Gel

Log in to view pricing!
View Sizes
109696 DEV-12-DSG8 DEV-12-DSG8 1 DEFINING SPRAY GEL Strong Hold No-Crunch Styler 8 Fl. Oz. DevaCurl DevaCurl DEFINING SPRAY GEL Strong Hold No-Crunch Styler 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsdefiningspraygel8oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEFINING SPRAY GEL Strong Hold No-Crunch Styler previously CURL MAKER, this non-flaking formula with a strong curl-locking blend provides definition to enhance your natural texture. True Log in to view pricing! False

DevaCurl
DEFINING SPRAY GEL Strong Hold No-Crunch Styler

8 Fl. Oz.

SKU DEV-12-DSG8

Log in to view pricing!
Quick View