devacurl style & shape

(18 Items)

142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 21.00 21.00 15.75 True True Valid Thru 04/30/24 False False 15.75 False False Diversion contract is required 0 DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Promotional ItemLog in to view pricing!
View Sizes
109721 DEV-12-FF8 DEV-12-FF8 1 FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. DevaCurl DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. True devacurl/devagsflexfactor8oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXFACTOR Curl Protection & Retention Primer is a heat and UV protective spray with the Curl Memory Complex protects from breakage from friction. True Log in to view pricing! False

DevaCurl
FLEXFACTOR Curl Protection & Retention Primer

On SaleLog in to view pricing!
View Sizes
109696 DEV-12-DSG8 DEV-12-DSG8 1 DEFINING SPRAY GEL Strong Hold No-Crunch Styler 8 Fl. Oz. DevaCurl DevaCurl DEFINING SPRAY GEL Strong Hold No-Crunch Styler 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsdefiningspraygel8oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEFINING SPRAY GEL Strong Hold No-Crunch Styler previously CURL MAKER, this non-flaking formula with a strong curl-locking blend provides definition to enhance your natural texture. True Log in to view pricing! False

DevaCurl
DEFINING SPRAY GEL Strong Hold No-Crunch Styler

8 Fl. Oz.

SKU DEV-12-DSG8

Log in to view pricing!
Quick View
135792 DEV-05-DFD6 DEV-05-DFD6 1 DEVAFAST DRY Accelerator Spray 6 Fl. Oz. DevaCurl DevaCurl DEVAFAST DRY Accelerator Spray 6 Fl. Oz. False devacurl/devacurldevafastdrydryacceleratorspray6oz.jpg Bonus Deal Available 15.75 15.75 15.75 False False False False 0.00 False False Diversion contract is required 0 Speed up your air-dry & diffusing time up to 66% with Devacurl's DEVAFAST DRY Accelerator Spray! This lightweight dry accelerating spray helps accelerate the rate at which water evaporates from the hair's surface. True Log in to view pricing! False

DevaCurl
DEVAFAST DRY Accelerator Spray

6 Fl. Oz.

SKU DEV-05-DFD6

Log in to view pricing!
Quick View
109682 DEV-12-DF3 DEV-12-DF3 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg Bonus Deal Available 11.55 11.55 11.55 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

3 Fl. Oz.

SKU DEV-12-DF3

Log in to view pricing!
Quick View
109679 DEV-05-FHH10 DEV-05-FHH10 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

10 Fl. Oz.

SKU DEV-05-FHH10

Log in to view pricing!
Quick View
122879 DEV-12-SCR5F DEV-12-SCR5F 1 Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicsupercream51floz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM's hydra-definition blend provides coarse curls with smoothness, shape, shine and frizz control. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic SUPERCREAM

5.1 Fl. Oz.

SKU DEV-12-SCR5F

Log in to view pricing!
Quick View
122877 DEV-12-UDG12F DEV-12-UDG12F 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU DEV-12-UDG12F

Log in to view pricing!
Quick View
109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Log in to view pricing!
View Sizes
109741 DEV-12-MS8 DEV-12-MS8 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 15.45 15.45 15.45 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

8 Fl. Oz.

SKU DEV-12-MS8

Log in to view pricing!
Quick View
109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Log in to view pricing!
View Sizes
109745 DEV-12-SC5 DEV-12-SC5 1 STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevacurlstylingcream51oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False

DevaCurl
STYLING CREAM Touchable Moisturizing Definer

Log in to view pricing!
View Sizes
138280 DEV-12-HSC17 DEV-12-HSC17 1 STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz. False devacurl/hol22devacurlstylingcreamlimitededitionjumbo17oz.jpg Bonus Deal Available 39.00 39.00 39.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False

DevaCurl
STYLING CREAM Touchable Moisturizing Definer Limited Edition

17.75 Fl. Oz.

SKU DEV-12-HSC17

Log in to view pricing!
Quick View
109748 DEV-12-SCR5 DEV-12-SCR5 1 SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupercream51oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

Log in to view pricing!
View Sizes
109764 DEV-12-SM5 DEV-12-SM5 1 SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. DevaCurl DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagssupermousse5oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer gives curls day 3 volume on day 1 with enhanced bounce, shine, and a soft, no-crunch finish. Humidity-resistant formula reduces frizz and flyaways as well. True Log in to view pricing! False

DevaCurl
SUPERMOUSSE Coconut Oil Infused Volumizer

5 Fl. Oz.

SKU DEV-12-SM5

Log in to view pricing!
Quick View