styling

(341 Items)

52717 TRS-12-HAPR8 TRS-12-HAPR8 1 Hair Protector 8.45 Fl. Oz. Truss Truss Hair Protector 8.45 Fl. Oz. False truss/trusshairprotector8.45.jpg Bonus Deal Available 15.45 15.45 15.45 False False False 0.00 False False Diversion contract is required 0 Truss Hair Protector is a lightweight gel/cream-based daily leave-in that restores hair's natural structure, detangles, and offers thermal protection from the blow dryer and flat iron. True Log in to view pricing! False

Truss
Hair Protector

8.45 Fl. Oz.

SKU TRS-12-HAPR8

Log in to view pricing!
Quick View
81439 BOS-12-VTM6 BOS-12-VTM6 1 Volumizing & Thickening Styling Mousse 6.6 Fl. Oz. Bosley MD Bosley MD BosVolumize Volumizing & Thickening Styling Mousse 6.6 Fl. Oz. False bosleypro/bosleymdbosvolumizestylingmousse6oz.jpg Bonus Deal Available 12.50 12.50 6.25 True True Valid Thru 02/28/23 False 6.25 False False Diversion contract is required 0 Bosley BosVolumize Volumizing & Thickening Styling Mousse is a weightless, non-alcohol, flexible medium-hold styling mousse that creates thicker, fuller-looking hair as you strengthen and thicken the hair shaft. True Log in to view pricing! False

Bosley MD
BosVolumize Volumizing & Thickening Styling Mousse

6.6 Fl. Oz.

SKU BOS-12-VTM6

Promotional ItemLog in to view pricing!
Quick View
109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Promotional ItemLog in to view pricing!
View Sizes
138280 DEV-12-HSC17 DEV-12-HSC17 1 STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz. False devacurl/hol22devacurlstylingcreamlimitededitionjumbo17oz.jpg Bonus Deal Available 39.00 39.00 33.15 True True Valid Thru 02/28/23 False 33.15 False False Diversion contract is required 0 DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False

DevaCurl
STYLING CREAM Touchable Moisturizing Definer Limited Edition

17.75 Fl. Oz.

SKU DEV-12-HSC17

Promotional ItemLog in to view pricing!
Quick View
138331 DEV-12-HSCR17 DEV-12-HSCR17 1 SUPERCREAM Rich Coconut-Infused Definer 17.75 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 17.75 Fl. Oz. False devacurl/hol22devacurlsupercream.jpg Bonus Deal Available 39.00 39.00 33.15 True True Valid Thru 02/28/23 False 33.15 False False Diversion contract is required 0 DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

17.75 Fl. Oz.

SKU DEV-12-HSCR17

Promotional ItemLog in to view pricing!
Quick View
109756 DEV-12-SDG12 DEV-12-SDG12 1 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupremedefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False 0.00 False False Diversion contract is required 0 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler previousl Arc AnGel Gel provides definition without the crunch. True Log in to view pricing! False

DevaCurl
SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
70827 LOM-12-CMC8 LOM-12-CMC8 1 Calming Crème 8 Fl. Oz. LOMA LOMA Calming Crème 8 Fl. Oz. True loma/lomacc8oz.jpg Bonus Deal Available 12.15 12.15 9.11 True True Valid Thru 02/28/23 False 9.11 False True Diversion contract is required 0 LOMA Calming Crème quenches thirsty hair, weightlessly detangling, softening, and taming frizz while also adding shine and protecting hair during thermal styling. True Log in to view pricing! False

LOMA
Calming Crème

Promotional ItemLog in to view pricing!
View Sizes
70749 LOM-03-DC8 LOM-03-DC8 1 Deep Conditioner 8 Fl. Oz. LOMA LOMA Deep Conditioner 8 Fl. Oz. True loma/lomadeepcond8oz.jpg Bonus Deal Available 13.25 13.25 9.94 True True Valid Thru 02/28/23 False 9.94 False True Diversion contract is required 0 LOMA Deep Conditioner is a triple use product that can be used as an intensive deep conditioner, luxurious cleansing conditioner, and a texturizing styler! True Log in to view pricing! False

LOMA
Deep Conditioner

Promotional ItemLog in to view pricing!
View Sizes
70972 LOM-05-TS6 LOM-05-TS6 1 Texture & Finishing Spray 5.4 Fl. Oz. LOMA LOMA Texture & Finishing Spray 5.4 Fl. Oz. False loma/lomatexturefinishingspray.jpg Bonus Deal Available 13.15 13.15 9.21 True True Valid Thru 02/28/23 False 9.21 False True Diversion contract is required 0 LOMA Texture & Finishing Spray gives an undone style with hold. True Log in to view pricing! False

LOMA
Texture & Finishing Spray

5.4 Fl. Oz.

SKU LOM-05-TS6

Promotional ItemLog in to view pricing!
Quick View
84282 BOS-12-SBSG5 BOS-12-SBSG5 1 Style+ Blow Dry & Styling Gel 5.1 Fl. Oz. Bosley MD Bosley MD BosVolumize Style+ Blow Dry & Styling Gel 5.1 Fl. Oz. False bosleypro/bosleymdbosvolumizestylegel5oz.jpg Bonus Deal Available 9.50 9.50 9.50 False True Valid Thru 02/28/23 False 0.00 False False Diversion contract is required 0 Bosley BosVolumize Style+ Blow Dry & Styling Gel helps provide thicker, fuller-looking hair with maximum style durability and superior humidity-resistant hold. True Log in to view pricing! False

Bosley MD
BosVolumize Style+ Blow Dry & Styling Gel

5.1 Fl. Oz.

SKU BOS-12-SBSG5

Promotional ItemLog in to view pricing!
Quick View
142279 DEV-03-MOW10 DEV-03-MOW10 1 Mist of Wonders Leave-In 10 Fl. Oz. DevaCurl DevaCurl Mist of Wonders Leave-In 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 21.00 21.00 21.00 False True Valid Thru 02/28/23 False 0.00 False False Diversion contract is required 0 DevaCurl Mist of Wonders Leave-In is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
Mist of Wonders Leave-In

Promotional ItemLog in to view pricing!
View Sizes
127106 KCX-25-JFE16 KCX-25-JFE16 1 EXPRESS BLOW OUT 16 oz. 2 pc. Keratin Complex Keratin Complex EXPRESS BLOW OUT 16 oz. 2 pc. False keratincomplex/jf23keratincomplexexpressblowout.jpg Bonus Deal Available 210.00 210.00 210.00 False True Valid Thru 02/28/23 False 0.00 False False Diversion contract is required 0 Keratin Complex EXPRESS BLOW OUT 16 oz. includes shampoo, treatment, and lightener.
Purchase 1:
EBO Banded Duo 16 oz.
Includes 1 Each: KC PRIMER Pre-Treatment Shampoo 16 oz. and EBO 16 oz.
Receive 1 FREE:
It’s A Blonde Thing Keratin Lightening System 1 lb. True Log in to view pricing! False

Keratin Complex
EXPRESS BLOW OUT 16 oz.

2 pc.

SKU KCX-25-JFE16

Promotional ItemLog in to view pricing!
Quick View
141440 MLB-25-JFHPM MLB-25-JFHPM 1 Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE! 6 pc. Milbon Milbon Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE! 6 pc. False milbon/jf23milbonbuy5repairheatprotectivemistget1free.jpg Bonus Deal Available 100.00 100.00 100.00 False True Valid Thru 02/28/23 False 0.00 False True Diversion contract is required 0 Milbon Buy 5 Signature REPAIR HEAT Protective Mist, Get 1 FREE!
Purchase 5:
REPAIR HEAT Protective Mist 4.1 oz.
Receive 1 FREE:
REPAIR HEAT Protective Mist 4.1 oz. True Log in to view pricing! False

Milbon
Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE!

6 pc.

SKU MLB-25-JFHPM

Promotional ItemLog in to view pricing!
Quick View