Jan/Feb Magazine

styling

(341 Items)
  • 52717 TRS-12-HAPR8 TRS-12-HAPR8 1 Hair Protector 8.45 Fl. Oz. Truss Truss Hair Protector 8.45 Fl. Oz. False truss/trusshairprotector8.45.jpg Bonus Deal Available 15.45 15.45 15.45 False False False 0.00 False False Diversion contract is required 0 Truss Hair Protector is a lightweight gel/cream-based daily leave-in that restores hair's natural structure, detangles, and offers thermal protection from the blow dryer and flat iron. True Log in to view pricing! False
    Truss Hair Protector 8.45 Fl. Oz.

    Truss
    Hair Protector

    8.45 Fl. Oz.

    SKU TRS-12-HAPR8

    Bonus Offer
    Quick View
  • 81439 BOS-12-VTM6 BOS-12-VTM6 1 Volumizing & Thickening Styling Mousse 6.6 Fl. Oz. Bosley MD Bosley MD BosVolumize Volumizing & Thickening Styling Mousse 6.6 Fl. Oz. False bosleypro/bosleymdbosvolumizestylingmousse6oz.jpg Bonus Deal Available 12.50 12.50 6.25 True True Valid Thru 02/28/23 False 6.25 False False Diversion contract is required 0 Bosley BosVolumize Volumizing & Thickening Styling Mousse is a weightless, non-alcohol, flexible medium-hold styling mousse that creates thicker, fuller-looking hair as you strengthen and thicken the hair shaft. True Log in to view pricing! False
    Bosley MD Volumizing & Thickening Styling Mousse 6.6 Fl. Oz.

    Bosley MD
    BosVolumize Volumizing & Thickening Styling Mousse

    6.6 Fl. Oz.

    SKU BOS-12-VTM6

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 138280 DEV-12-HSC17 DEV-12-HSC17 1 STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz. False devacurl/hol22devacurlstylingcreamlimitededitionjumbo17oz.jpg Bonus Deal Available 39.00 39.00 33.15 True True Valid Thru 02/28/23 False 33.15 False False Diversion contract is required 0 DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False
    DevaCurl STYLING CREAM Touchable Moisturizing Definer Limited Edition 17.75 Fl. Oz.

    DevaCurl
    STYLING CREAM Touchable Moisturizing Definer Limited Edition

    17.75 Fl. Oz.

    SKU DEV-12-HSC17

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 138331 DEV-12-HSCR17 DEV-12-HSCR17 1 SUPERCREAM Rich Coconut-Infused Definer 17.75 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 17.75 Fl. Oz. False devacurl/hol22devacurlsupercream.jpg Bonus Deal Available 39.00 39.00 33.15 True True Valid Thru 02/28/23 False 33.15 False False Diversion contract is required 0 DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False
    DevaCurl SUPERCREAM Rich Coconut-Infused Definer 17.75 Fl. Oz.

    DevaCurl
    SUPERCREAM Rich Coconut-Infused Definer

    17.75 Fl. Oz.

    SKU DEV-12-HSCR17

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 109756 DEV-12-SDG12 DEV-12-SDG12 1 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupremedefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False 0.00 False False Diversion contract is required 0 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler previousl Arc AnGel Gel provides definition without the crunch. True Log in to view pricing! False
    DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 70827 LOM-12-CMC8 LOM-12-CMC8 1 Calming Crème 8 Fl. Oz. LOMA LOMA Calming Crème 8 Fl. Oz. True loma/lomacc8oz.jpg Bonus Deal Available 12.15 12.15 9.11 True True Valid Thru 02/28/23 False 9.11 False True Diversion contract is required 0 LOMA Calming Crème quenches thirsty hair, weightlessly detangling, softening, and taming frizz while also adding shine and protecting hair during thermal styling. True Log in to view pricing! False
    LOMA Calming Crème 8 Fl. Oz.

    LOMA
    Calming Crème

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 70749 LOM-03-DC8 LOM-03-DC8 1 Deep Conditioner 8 Fl. Oz. LOMA LOMA Deep Conditioner 8 Fl. Oz. True loma/lomadeepcond8oz.jpg Bonus Deal Available 13.25 13.25 9.94 True True Valid Thru 02/28/23 False 9.94 False True Diversion contract is required 0 LOMA Deep Conditioner is a triple use product that can be used as an intensive deep conditioner, luxurious cleansing conditioner, and a texturizing styler! True Log in to view pricing! False
    LOMA Deep Conditioner 8 Fl. Oz.

    LOMA
    Deep Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 70972 LOM-05-TS6 LOM-05-TS6 1 Texture & Finishing Spray 5.4 Fl. Oz. LOMA LOMA Texture & Finishing Spray 5.4 Fl. Oz. False loma/lomatexturefinishingspray.jpg Bonus Deal Available 13.15 13.15 9.21 True True Valid Thru 02/28/23 False 9.21 False True Diversion contract is required 0 LOMA Texture & Finishing Spray gives an undone style with hold. True Log in to view pricing! False
    LOMA Texture & Finishing Spray 5.4 Fl. Oz.

    LOMA
    Texture & Finishing Spray

    5.4 Fl. Oz.

    SKU LOM-05-TS6

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 84282 BOS-12-SBSG5 BOS-12-SBSG5 1 Style+ Blow Dry & Styling Gel 5.1 Fl. Oz. Bosley MD Bosley MD BosVolumize Style+ Blow Dry & Styling Gel 5.1 Fl. Oz. False bosleypro/bosleymdbosvolumizestylegel5oz.jpg Bonus Deal Available 9.50 9.50 9.50 False True Valid Thru 02/28/23 False 0.00 False False Diversion contract is required 0 Bosley BosVolumize Style+ Blow Dry & Styling Gel helps provide thicker, fuller-looking hair with maximum style durability and superior humidity-resistant hold. True Log in to view pricing! False
    Bosley MD Style+ Blow Dry & Styling Gel 5.1 Fl. Oz.

    Bosley MD
    BosVolumize Style+ Blow Dry & Styling Gel

    5.1 Fl. Oz.

    SKU BOS-12-SBSG5

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 142279 DEV-03-MOW10 DEV-03-MOW10 1 Mist of Wonders Leave-In 10 Fl. Oz. DevaCurl DevaCurl Mist of Wonders Leave-In 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 21.00 21.00 21.00 False True Valid Thru 02/28/23 False 0.00 False False Diversion contract is required 0 DevaCurl Mist of Wonders Leave-In is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False
    DevaCurl Mist of Wonders Leave-In 10 Fl. Oz.

    DevaCurl
    Mist of Wonders Leave-In

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 127106 KCX-25-JFE16 KCX-25-JFE16 1 EXPRESS BLOW OUT 16 oz. 2 pc. Keratin Complex Keratin Complex EXPRESS BLOW OUT 16 oz. 2 pc. False keratincomplex/jf23keratincomplexexpressblowout.jpg Bonus Deal Available 210.00 210.00 210.00 False True Valid Thru 02/28/23 False 0.00 False False Diversion contract is required 0 Keratin Complex EXPRESS BLOW OUT 16 oz. includes shampoo, treatment, and lightener.
    Purchase 1:
    EBO Banded Duo 16 oz.
    Includes 1 Each: KC PRIMER Pre-Treatment Shampoo 16 oz. and EBO 16 oz.
    Receive 1 FREE:
    It’s A Blonde Thing Keratin Lightening System 1 lb.
    True Log in to view pricing! False
    Keratin Complex EXPRESS BLOW OUT 16 oz. 2 pc.

    Keratin Complex
    EXPRESS BLOW OUT 16 oz.

    2 pc.

    SKU KCX-25-JFE16

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 141440 MLB-25-JFHPM MLB-25-JFHPM 1 Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE! 6 pc. Milbon Milbon Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE! 6 pc. False milbon/jf23milbonbuy5repairheatprotectivemistget1free.jpg Bonus Deal Available 100.00 100.00 100.00 False True Valid Thru 02/28/23 False 0.00 False True Diversion contract is required 0 Milbon Buy 5 Signature REPAIR HEAT Protective Mist, Get 1 FREE!
    Purchase 5:
    REPAIR HEAT Protective Mist 4.1 oz.  
    Receive 1 FREE:
    REPAIR HEAT Protective Mist 4.1 oz.
    True Log in to view pricing! False
    Milbon Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE! 6 pc.

    Milbon
    Buy 5 REPAIR HEAT Protective Mist, Get 1 FREE!

    6 pc.

    SKU MLB-25-JFHPM

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
(341 Items)