Spring Education is Here! VIEW NOW

devacurl

(61 Items)
  • 109570 DEV-03-BUB8 DEV-03-BUB8 1 BUILDUP BUSTER Gentle Clarifying Cleanser 8 Fl. Oz. DevaCurl DevaCurl BUILDUP BUSTER Gentle Clarifying Cleanser 8 Fl. Oz. True devacurl/devagsbuildupbuster8oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl BUILDUP BUSTER Gentle Clarifying Cleanser is a non-stripping cleanser with Clarifying Complex helps remove product buildup on all curl types. True Log in to view pricing! False
    DevaCurl BUILDUP BUSTER Gentle Clarifying Cleanser 8 Fl. Oz.

    DevaCurl
    BUILDUP BUSTER Gentle Clarifying Cleanser

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109579 DEV-03-CB12 DEV-03-CB12 1 CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. True devacurl/devagscurlbondconditioner12oz(1).jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Cream Conditioner with Patented CurlBond Complex re-coils damaged curls, softens, detangles, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Cream Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109473 DEV-02-CB12 DEV-02-CB12 1 CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. True devacurl/devagscurlbondcleanser12oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109589 DEV-03-CBM8 DEV-03-CBM8 1 CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. True devacurl/devacurlcurlbond8floz.jpg Bonus Deal Available 22.65 22.65 22.65 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Treatment Mask is a rich, reparative mask with Patented CURLBOND Complex re-coils damaged curls, conditions, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Treatment Mask

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109614 DEV-03-HIH8 DEV-03-HIH8 1 HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz. DevaCurl DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz. True devacurl/devacurlheaveninhair8oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz.

    DevaCurl
    HEAVEN IN HAIR Moisturizing Deep Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109619 DEV-03-MIM8 DEV-03-MIM8 1 MELT INTO MOISTURE Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl MELT INTO MOISTURE Treatment Mask 8 Fl. Oz. True devacurl/devagsmeltintomoisture8oz.jpg Bonus Deal Available 22.65 22.65 22.65 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MELT INTO MOISTURE Treatment Mask is a great weekly treat for your curls. True Log in to view pricing! False
    DevaCurl MELT INTO MOISTURE Treatment Mask 8 Fl. Oz.

    DevaCurl
    MELT INTO MOISTURE Treatment Mask

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109484 DEV-02-DNP12 DEV-02-DNP12 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoodecadence12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109530 DEV-02-NP12 DEV-02-NP12 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoooriginal12oz(1).jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109603 DEV-03-DOC12 DEV-03-DOC12 1 ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsoneconditiondecadence12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner designed for dry, coarse curls. True Log in to view pricing! False
    DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz.

    DevaCurl
    ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109636 DEV-03-OC12 DEV-03-OC12 1 ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz. True devacurl/devagsoneconditionoriginal12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION ORIGINAL Rich Creamy Conditioner is designed for dry, medium to Coarse Curls with olive oil and nourishing botanicals. True Log in to view pricing! False
    DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz.

    DevaCurl
    ONE CONDITION ORIGINAL Rich Cream Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.40 13.40 13.40 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109756 DEV-12-SDG12 DEV-12-SDG12 1 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupremedefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler previousl Arc AnGel Gel provides definition without the crunch. True Log in to view pricing! False
    DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. False Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109675 DEV-03-WDW12 DEV-03-WDW12 1 WASH DAY WONDER Time-Saving Slip Detangler 12 Fl. Oz. DevaCurl DevaCurl WASH DAY WONDER Time-Saving Slip Detangler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagswashdaywonder12oz.jpg Bonus Deal Available 17.50 17.50 17.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl WASH DAY WONDER Time-Saving Slip Detangler is a slip-enhancing formula with Tangle-Release Complex melts away tangles to ease wash day and styling so tangle-prone curls are softer and more manageable. True Log in to view pricing! False
    DevaCurl WASH DAY WONDER Time-Saving Slip Detangler 12 Fl. Oz.

    DevaCurl
    WASH DAY WONDER Time-Saving Slip Detangler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
(61 Items)