DevaCurl Hair Products | TruBeauty Concepts

Save 10–20% plus free shipping on qualifying orders! Ends Oct 12.

September/October Magazine Now Available!

Explore The Latest Deals!

(18 Items)

183523 so26devacurlsave25onstylers so26devacurlsave25onstylers 1 Save 25% on Retail Stylers Click to View Options DevaCurl DevaCurl Save 25% on Retail Stylers Click to View Options False devacurl/so26devacurlpgsave25onstylers.jpg Bonus Deal Available 0.00 0.00 0.00 False True Valid Thru 10/31/26 False False 0.00 True False Diversion contract is required True Log in to view pricing! False

DevaCurl
Save 25% on Retail Stylers

Promotional ItemLog in to view pricing!
View Details
109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 14.00 14.00 10.50 True True Valid Thru 10/31/26 False False 10.50 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
171889 DEV-12-QNG12 DEV-12-QNG12 1 QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. False devacurl/devacurlquenchn_definegel12oz.jpg Bonus Deal Available 12.00 12.00 9.00 True True Valid Thru 10/31/26 False False 9.00 False False Diversion contract is required DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler locks in moisture, enhances shine, provides curl definition, and controls frizz without crunch or flaking! True Log in to view pricing! False

DevaCurl
QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler

12 Fl. Oz.

SKU DEV-12-QNG12

Promotional ItemLog in to view pricing!
Quick View
179962 DEV-12-QNC12 DEV-12-QNC12 1 QUENCH'N STRETCH CREAM Moisturizing Defining Curl Cream 12 Fl. Oz. DevaCurl DevaCurl QUENCH'N STRETCH CREAM Moisturizing Defining Curl Cream 12 Fl. Oz. False devacurl/devacurlquenchnstretchcream12flozup.jpg Bonus Deal Available 14.50 14.50 10.88 True True Valid Thru 10/31/26 False False 10.88 False False Diversion contract is required DevaCurl QUENCH'N STETCH CREAM Moisturizing Defining Curl Cream is for dry coils and curls. False Log in to view pricing! False

DevaCurl
QUENCH'N STRETCH CREAM Moisturizing Defining Curl Cream

12 Fl. Oz.

SKU DEV-12-QNC12

Promotional ItemLog in to view pricing!
Quick View
109745 DEV-12-SC5 DEV-12-SC5 1 STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevacurlstylingcream51oz.jpg Bonus Deal Available 14.50 14.50 10.88 True True Valid Thru 10/31/26 False False 10.88 False False Diversion contract is required DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False

DevaCurl
STYLING CREAM Touchable Moisturizing Definer

Promotional ItemLog in to view pricing!
View Sizes
109748 DEV-12-SCR5 DEV-12-SCR5 1 SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupercream51oz.jpg Bonus Deal Available 14.50 14.50 10.88 True True Valid Thru 10/31/26 False False 10.88 False False Diversion contract is required DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

Promotional ItemLog in to view pricing!
View Sizes
109764 DEV-12-SM5 DEV-12-SM5 1 SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. DevaCurl DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagssupermousse5oz.jpg Bonus Deal Available 14.50 14.50 10.88 True True Valid Thru 10/31/26 False False 10.88 False False Diversion contract is required DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer gives curls day 3 volume on day 1 with enhanced bounce, shine, and a soft, no-crunch finish. Humidity-resistant formula reduces frizz and flyaways as well. True Log in to view pricing! False

DevaCurl
SUPERMOUSSE Coconut Oil Infused Volumizer

5 Fl. Oz.

SKU DEV-12-SM5

Promotional ItemLog in to view pricing!
Quick View
109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 14.00 14.00 10.50 True True Valid Thru 10/31/26 False False 10.50 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109769 DEV-12-WM5 DEV-12-WM5 1 WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz. DevaCurl DevaCurl WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagswavemaker5oz.jpg Bonus Deal Available 14.50 14.50 10.88 True True Valid Thru 10/31/26 False False 10.88 False False Diversion contract is required DevaCurl WAVE MAKER Lightweight Moisturizing Definer is a lightweight cream with a hydra-definition blend that provides fine curls with shape and frizz control. True Log in to view pricing! False

DevaCurl
WAVE MAKER Lightweight Moisturizing Definer

Promotional ItemLog in to view pricing!
View Sizes
184280 DEV-19-H26QK DEV-19-H26QK 1 The QUENCH'N Holiday Duo 3 pc. DevaCurl DevaCurl The QUENCH'N Holiday Duo 3 pc. False devacurl/dvthequenchnholidayduo3pc.jpg Bonus Deal Available 14.00 14.00 14.00 False True Valid Thru 12/31/26 False False 0.00 False False Diversion contract is required DevaCurl The QUENCH'N Holiday Duo includes cream, gel, and bag.
Includes:
1 QUENCH'N STRETCH CREAM Moisturizing Defining Curl Cream 3 oz.
1 QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 3 oz.
1 Cosmetic Bag True Log in to view pricing! False

DevaCurl
The QUENCH'N Holiday Duo

3 pc.

SKU DEV-19-H26QK

Promotional ItemLog in to view pricing!
Quick View
109679 DEV-05-FHH10 DEV-05-FHH10 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

10 Fl. Oz.

SKU DEV-05-FHH10

Log in to view pricing!
Quick View
142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Log in to view pricing!
View Sizes
109741 DEV-12-MS8 DEV-12-MS8 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

8 Fl. Oz.

SKU DEV-12-MS8

Log in to view pricing!
Quick View
109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Log in to view pricing!
View Sizes
153906 DEV-21-LGK24 DEV-21-LGK24 1 Salon Opener Large Kit DevaCurl DevaCurl Salon Opener Large Kit False devacurl/devacurlsalonopenerlargekit57pc.jpg Bonus Deal Available 999.00 999.00 999.00 False False False False 0.00 False False Diversion contract is required DevaCurl Salon Opener Large Kit includes cleanser, conditioner, leave-in, masks, serum, treatment, gel, cream, definer, foam, spray, primer, towels, diffuser, and dryer. True Log in to view pricing! False

DevaCurl
Salon Opener Large Kit

SKU DEV-21-LGK24

Log in to view pricing!
Quick View