devacurl

Summer Savings, New Finds: July/August Promos Just Landed |

Fresh Arrivals, Big Deals—Log In to Unlock Our July/August Magazine!

(20 Items)

109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
166097 DEV-25-MAMW1 DEV-25-MAMW1 1 Buy 1 MIST OF WONDERS LEAVE-IN 10 oz., Get 1 at 50% OFF! 2 pc. DevaCurl DevaCurl Buy 1 MIST OF WONDERS LEAVE-IN 10 oz., Get 1 at 50% OFF! 2 pc. False devacurl/ma25devacurlbuy1get150offleaveinwonder.jpg Bonus Deal Available 30.00 30.00 30.00 False False False False 0.00 False False Diversion contract is required DevaCurl Buy 1 MIST OF WONDERS LEAVE-IN 10 oz., Get 1 at 50% OFF!
Purchase:
1 MIST OF WONDERS LEAVE-IN 10 oz.
Receive at 50% OFF:
1 MIST OF WONDERS LEAVE-IN 10 oz. True Log in to view pricing! False

DevaCurl
Buy 1 MIST OF WONDERS LEAVE-IN 10 oz., Get 1 at 50% OFF!

2 pc.

SKU DEV-25-MAMW1

Log in to view pricing!
Quick View
166098 DEV-25-MAMW2 DEV-25-MAMW2 1 Buy 1 MIST OF WONDERS LEAVE-IN 24 oz., Get 1 at 50% OFF! 2 pc. DevaCurl DevaCurl Buy 1 MIST OF WONDERS LEAVE-IN 24 oz., Get 1 at 50% OFF! 2 pc. False devacurl/ma25devacurlbuy1get150offleaveinwonder24.jpg Bonus Deal Available 39.75 39.75 39.75 False False False False 0.00 False False Diversion contract is required DevaCurl Buy 1 MIST OF WONDERS LEAVE-IN 24 oz., Get 1 at 50% OFF!
Purchase:
1 MIST OF WONDERS LEAVE-IN 24 oz.
Receive at 50% OFF:
1 MIST OF WONDERS LEAVE-IN 24 oz. True Log in to view pricing! False

DevaCurl
Buy 1 MIST OF WONDERS LEAVE-IN 24 oz., Get 1 at 50% OFF!

2 pc.

SKU DEV-25-MAMW2

Log in to view pricing!
Quick View
109682 DEV-12-DF3 DEV-12-DF3 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg Bonus Deal Available 11.00 11.00 11.00 False False False False 0.00 False False Diversion contract is required DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

3 Fl. Oz.

SKU DEV-12-DF3

Log in to view pricing!
Quick View
109679 DEV-05-FHH10 DEV-05-FHH10 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

10 Fl. Oz.

SKU DEV-05-FHH10

Log in to view pricing!
Quick View
122877 DEV-12-UDG12F DEV-12-UDG12F 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU DEV-12-UDG12F

Log in to view pricing!
Quick View
142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 20.00 20.00 20.00 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. False Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Log in to view pricing!
View Sizes
109741 DEV-12-MS8 DEV-12-MS8 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

8 Fl. Oz.

SKU DEV-12-MS8

Log in to view pricing!
Quick View
109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Log in to view pricing!
View Sizes
153906 DEV-21-LGK24 DEV-21-LGK24 1 Salon Opener Large Kit DevaCurl DevaCurl Salon Opener Large Kit False devacurl/devacurlsalonopenerlargekit57pc.jpg Bonus Deal Available 999.00 999.00 999.00 False False False False 0.00 False False Diversion contract is required DevaCurl Salon Opener Large Kit includes cleanser, conditioner, leave-in, masks, serum, treatment, gel, cream, definer, foam, spray, primer, towels, diffuser, and dryer. True Log in to view pricing! False

DevaCurl
Salon Opener Large Kit

SKU DEV-21-LGK24

Log in to view pricing!
Quick View
153900 DEV-21-SMK24 DEV-21-SMK24 1 Salon Opener Small Kit DevaCurl DevaCurl Salon Opener Small Kit False devacurl/devacurlsmallkit.jpg Bonus Deal Available 495.00 495.00 495.00 False False False False 0.00 False False Diversion contract is required DevaCurl Salon Opener Small Kit includes cleanser, conditioner, masks, serum, treatment, gel, cream, mist, foam, towel, and diffuser. True Log in to view pricing! False

DevaCurl
Salon Opener Small Kit

SKU DEV-21-SMK24

Log in to view pricing!
Quick View
153898 DEV-21-STK24 DEV-21-STK24 1 Salon Opener Starter Kit 7 pc. DevaCurl DevaCurl Salon Opener Starter Kit 7 pc. False devacurl/devacurlstarterkit.jpg Bonus Deal Available 99.00 99.00 99.00 False False False False 0.00 False False Diversion contract is required DevaCurl Salon Opener Starter Kit includes cleanser, conditioner, gel, cream, spray, and foam. True Log in to view pricing! False

DevaCurl
Salon Opener Starter Kit

7 pc.

SKU DEV-21-STK24

Log in to view pricing!
Quick View
109666 DEV-03-SD1 DEV-03-SD1 1 SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz. DevaCurl DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz. False devacurl/devacurlnewpackagingdevagsscalpdphense1oz.jpg Bonus Deal Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum is a non-oily, nourishing serum with Scalp Re-Balancing Complex to moisturize dry scalp. True Log in to view pricing! False

DevaCurl
SCALP D(pH)ENSE Daily Nourishing & Protecting Serum

1 Fl. Oz.

SKU DEV-03-SD1

Log in to view pricing!
Quick View
109669 DEV-03-SP8 DEV-03-SP8 1 SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz. DevaCurl DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz. False devacurl/devascalppuriphydailynourishing8oz.jpg Bonus Deal Available 20.50 20.50 20.50 False False False False 0.00 False False Diversion contract is required DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray gently removes scalp buildup. False Log in to view pricing! False

DevaCurl
SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray

8 Fl. Oz.

SKU DEV-03-SP8

Log in to view pricing!
Quick View