hair care leave-in

Stock up & Save — Enjoy up to 30% Off Liters!

(86 Items)

174145 NAK-03-NRLI5 NAK-03-NRLI5 1 REPLENDS CRÈME LEAVE-IN MOISTURIZER 5.07 Fl. Oz. NAK Hair NAK Hair REPLENDS CRÈME LEAVE-IN MOISTURIZER 5.07 Fl. Oz. True nakhair/newnaksignature25replendscremelimois507oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required NAK Hair REPLENDS CRÈME LEAVE-IN MOISTURIZER moisturizes, softens, and protects hair. True Log in to view pricing! False

NAK Hair
REPLENDS CRÈME LEAVE-IN MOISTURIZER

Log in to view pricing!
View Sizes
65417 SDL-03-LIC6 SDL-03-LIC6 1 Nutritive Leave-in Conditioner 6.76 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner 6.76 Fl. Oz. True alfaparfmilano/am_sdl-moisture-nutritive-leave-in-conditioner-200ml.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner is a nourishing leave-in conditioner for dry hair: softens the hair fiber and makes it easier to control without weighing it down, for silky and radiant hair. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Moisture Nutritive Leave-in Conditioner

Promotional ItemLog in to view pricing!
View Sizes
142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 20.00 20.00 20.00 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Promotional ItemLog in to view pricing!
View Sizes
155360 SUR-03-AM4 SUR-03-AM4 1 MIST 4 Fl. Oz. Surface Hair Surface Hair AWAKEN MIST 4 Fl. Oz. False surfacehairhealthart/surfaceawakenmist4oz.jpg Bonus Deal Available 18.00 18.00 14.40 True True Valid Thru 02/28/26 False False 14.40 False False Diversion contract is required Surface Hair AWAKEN MIST is a leave in conditioner and detangler that uses natural botanicals to soothe fragile hair, Natural Capsicum and Menthol to stimulate, and vegan Amaranth, Soy, and Keravis protein blend to strengthen and support healthy hair. True Log in to view pricing! False

Surface Hair
AWAKEN MIST

4 Fl. Oz.

SKU SUR-03-AM4

Promotional ItemLog in to view pricing!
Quick View
155427 SUR-03-AE4 SUR-03-AE4 1 SCALP ELIXIR 4.7 Fl. Oz. Surface Hair Surface Hair AWAKEN SCALP ELIXIR 4.7 Fl. Oz. False surfacehairhealthart/surfaceawakenscalpelixir4oz.jpg Bonus Deal Available 21.00 21.00 16.80 True True Valid Thru 02/28/26 False False 16.80 False False Diversion contract is required Surface Hair AWAKEN SCALP ELIXIR is formulated with Sandalwood Extract & D-Biotin to speed up while strengthening cellular rejuvenation; delivering faster growing hair as well as longer, stronger, and thicker hair. True Log in to view pricing! False

Surface Hair
AWAKEN SCALP ELIXIR

4.7 Fl. Oz.

SKU SUR-03-AE4

Promotional ItemLog in to view pricing!
Quick View
155378 SUR-12-ATHS4 SUR-12-ATHS4 1 THICKENING SPRAY 4 Fl. Oz. Surface Hair Surface Hair AWAKEN THICKENING SPRAY 4 Fl. Oz. False surfacehairhealthart/surfaceawakenthickeningspray4oz.jpg Bonus Deal Available 17.25 17.25 13.80 True True Valid Thru 02/28/26 False False 13.80 False False Diversion contract is required Surface Hair AWAKEN THICKENING SPRAY is a pre-styling spray made with a botanical blend to protect the hair from heat and environmental damage while making the hair strands expand in diameter. True Log in to view pricing! False

Surface Hair
AWAKEN THICKENING SPRAY

4 Fl. Oz.

SKU SUR-12-ATHS4

Promotional ItemLog in to view pricing!
Quick View
157855 SUR-03-BMB2 SUR-03-BMB2 1 MOISTURE BOND LEAVE-IN TREATMENT 2.3 Fl. Oz. Surface Hair Surface Hair BASSU MOISTURE BOND LEAVE-IN TREATMENT 2.3 Fl. Oz. False surfacehair/surfacebassumoisturebondleaveintreatment2.3floz.jpg Bonus Deal Available 22.00 22.00 17.60 True True Valid Thru 02/28/26 False False 17.60 False False Diversion contract is required Surface Hair BASSU MOISTURE BOND LEAVE-IN TREATMENT is a cream to oil leave-in treatment that brings bleached, dry, damaged hair back to life. True Log in to view pricing! False

Surface Hair
BASSU MOISTURE BOND LEAVE-IN TREATMENT

2.3 Fl. Oz.

SKU SUR-03-BMB2

Promotional ItemLog in to view pricing!
Quick View
157841 SUR-03-TRT6 SUR-03-TRT6 1 REPAIR TONIC 6 Fl. Oz. Surface Hair Surface Hair TRINITY COLOR CARE REPAIR TONIC 6 Fl. Oz. True surfacehair/surfacetrinitycolorcarerepairtonic6floz.jpg Bonus Deal Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required Surface Hair TRINITY COLOR CARE REPAIR TONIC penetrates the hair for color retention, repair, shine, and conditioning. True Log in to view pricing! False

Surface Hair
TRINITY COLOR CARE REPAIR TONIC

Promotional ItemLog in to view pricing!
View Sizes
160753 SUR-03-TBR SUR-03-TBR 1 TRINITY BOND REPAIR LEAVE-IN TREATMENT 2.3 Fl. Oz. Surface Hair Surface Hair TRINITY COLOR CARE TRINITY BOND REPAIR LEAVE-IN TREATMENT 2.3 Fl. Oz. False surfacehair/surfacetrinitybondrepair.jpg Bonus Deal Available 22.00 22.00 17.60 True True Valid Thru 02/28/26 False False 17.60 False False Diversion contract is required Surface Hair TRINITY BOND REPAIR LEAVE-IN TREATMENT repairs and restores hair, achieving new levels of health and longer-lasting color. True Log in to view pricing! False

Surface Hair
TRINITY COLOR CARE TRINITY BOND REPAIR LEAVE-IN TREATMENT

2.3 Fl. Oz.

SKU SUR-03-TBR

Promotional ItemLog in to view pricing!
Quick View
175810 NAK-03-RPM5 NAK-03-RPM5 1 K.REVIVE EXPRESS REPAIR POWER MASK 5.07 Fl. Oz. NAK Hair NAK Hair K.REVIVE EXPRESS REPAIR POWER MASK 5.07 Fl. Oz. False nakhair/nakhairk-reviveexpressrepairpowermask5.07oz.jpg nakhair/jf26nakhairk.revivekit15pc.jpg NAK-25-JFR Bonus Deal Available 60.00 60.00 60.00 False True Valid Thru 02/28/26 False False 0.00 False False Diversion contract is required NAK Hair K.REVIVE EXPRESS REPAIR POWER MASK is a pro-only in-salon treatment designed to deliver instant strength, repair, and resilience from the very first application. True Log in to view pricing! False

NAK Hair
K.REVIVE EXPRESS REPAIR POWER MASK

5.07 Fl. Oz.

SKU NAK-03-RPM5

Bonus Deal Available

Promotional ItemLog in to view pricing!
Quick View
175809 NAK-03-KPLI2 NAK-03-KPLI2 1 K.REVIVE PEPTIDE LEAVE-IN POWER MASK 2.7 Fl. Oz. NAK Hair NAK Hair K.REVIVE PEPTIDE LEAVE-IN POWER MASK 2.7 Fl. Oz. False nakhair/nakhairk-revivepeptideleave-inpowermask2.7oz.jpg nakhair/jf26nakhairk.revivekit15pc.jpg NAK-25-JFR Bonus Deal Available 30.00 30.00 30.00 False True Valid Thru 02/28/26 False False 0.00 False False Diversion contract is required NAK Hair K.REVIVE PEPTIDE LEAVE-IN POWER MASK is a take-home treatment that is clinically proven to strengthen and repair hair up to 97% in just 2 minutes. True Log in to view pricing! False

NAK Hair
K.REVIVE PEPTIDE LEAVE-IN POWER MASK

2.7 Fl. Oz.

SKU NAK-03-KPLI2

Bonus Deal Available

Promotional ItemLog in to view pricing!
Quick View
154911 NAK-03-HDM3 NAK-03-HDM3 1 Hydrate Detangle Mist 3.52 Fl. Oz. NAK Hair NAK Hair Hydrate Detangle Mist 3.52 Fl. Oz. False nakhair/nakhairhydratemist3.52oz.jpg Bonus Deal Available 7.99 7.99 5.99 True False False False 5.99 False False Diversion contract is required NAK Hair HYDRATE DETANGLE MIST is a weightless detangling mist designed to hydrate and protect the hair from structural wear and tear. True Log in to view pricing! False

NAK Hair
Hydrate Detangle Mist

3.52 Fl. Oz.

SKU NAK-03-HDM3

On SaleLog in to view pricing!
Quick View
130165 WEL-03-ERLI5 WEL-03-ERLI5 1 Renewing Leave-in Spray 5.07 Fl. Oz. Wella Wella Professionals Elements Renewing Leave-in Spray 5.07 Fl. Oz. False wella/wellaelementrenewleaveinspray.jpg Bonus Deal Available 14.70 14.70 11.76 True False False False 11.76 False False Diversion contract is required Wella ELEMENTS Renewing Leave-in Spray is de-stressing and detangling spray that protects hair from daily mechanical stress (combing or heating tools) and breakage, while it hydrates and tames static or frizzy hair. True Log in to view pricing! False

Wella
Professionals Elements Renewing Leave-in Spray

5.07 Fl. Oz.

SKU WEL-03-ERLI5

On SaleLog in to view pricing!
Quick View
97994 WEL-12-EWB5 WEL-12-EWB5 1 Nutri-Enrich Wonder Balm 5.1 Fl. Oz. Wella Wella Professionals INVIGO Nutri-Enrich Wonder Balm 5.1 Fl. Oz. False wella/wellanutrienrichwonderbalm5oz.jpg Bonus Deal Available 12.20 12.20 9.76 True False False False 9.76 False False Diversion contract is required Wella Professionals Nutri-Enrich Wonder Balm provides instant deep nourishment for smoothness, manageability and movement. True Log in to view pricing! False

Wella
Professionals INVIGO Nutri-Enrich Wonder Balm

5.1 Fl. Oz.

SKU WEL-12-EWB5

On SaleLog in to view pricing!
Quick View
107970 ABA-03-AIOC8 ABA-03-AIOC8 1 COMPLETE ALL-IN-ONE LEAVE-IN SPRAY 8 Fl. Oz. ABBA® ABBA® pure specialty COMPLETE ALL-IN-ONE LEAVE-IN SPRAY 8 Fl. Oz. True abba/abbacompleteallinoneleaveinspray8oz.jpg abba/abbacompleteallinoneleaveinspray8oz-photoroom.jpg ABA-25-JFAIO Bonus Deal Available 11.50 11.50 11.50 False False False False 0.00 False False Diversion contract is required ABBA pure specialty COMPLETE ALL-IN-ONE LEAVE-IN SPRAY conditioner improves elasticity, moisturizes, and strengthens hair while reducing breakage. True Log in to view pricing! False

ABBA®
pure specialty COMPLETE ALL-IN-ONE LEAVE-IN SPRAY

Bonus Deal Available

Log in to view pricing!
View Sizes