hair care leave-in

July/August Magazine Now Available!

Explore The Latest Deals!

(92 Items)

174145 NAK-03-NRLI5 NAK-03-NRLI5 1 REPLENDS CRÈME LEAVE-IN MOISTURIZER 5.07 Fl. Oz. NAK Hair NAK Hair REPLENDS CRÈME LEAVE-IN MOISTURIZER 5.07 Fl. Oz. True nakhair/newnaksignature25replendscremelimois507oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required NAK Hair REPLENDS CRÈME LEAVE-IN MOISTURIZER moisturizes, softens, and protects hair. True Log in to view pricing! False

NAK Hair
REPLENDS CRÈME LEAVE-IN MOISTURIZER

Log in to view pricing!
View Sizes
65417 SDL-03-LIC6 SDL-03-LIC6 1 Nutritive Leave-in Conditioner 6.76 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner 6.76 Fl. Oz. True alfaparfmilano/am_sdl-moisture-nutritive-leave-in-conditioner-200ml.jpg Bonus Deal Available 15.14 15.14 15.14 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner is a nourishing leave-in conditioner for dry hair: softens the hair fiber and makes it easier to control without weighing it down, for silky and radiant hair. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Moisture Nutritive Leave-in Conditioner

Promotional ItemLog in to view pricing!
View Sizes
142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Promotional ItemLog in to view pricing!
View Sizes
162586 OLX-03-NO5M3 OLX-03-NO5M3 1 Nº.5 MOISTURIZE & MEND LEAVE-IN CONDITIONER 3.3 Fl. Oz. OLAPLEX OLAPLEX Nº.5 MOISTURIZE & MEND LEAVE-IN CONDITIONER 3.3 Fl. Oz. False olaplex/olaplexn5moisturizeandmendleaveinconditioner3.3floz.jpg Bonus Deal Available 17.00 17.00 12.75 True True Valid Thru 07/31/26 False False 12.75 False False Diversion contract is required OLAPLEX Nº.5 MOISTURIZE & MEND LEAVE-IN CONDITIONER is a moisturizing leave-in conditioner with a gel-creme texture to instantly hydrate and seal split ends. True Log in to view pricing! False

OLAPLEX
Nº.5 MOISTURIZE & MEND LEAVE-IN CONDITIONER

3.3 Fl. Oz.

SKU OLX-03-NO5M3

Promotional ItemLog in to view pricing!
Quick View
146065 ORL-03-ER5 ORL-03-ER5 1 Ends Remedy 5.07 Fl. Oz. ORI LAB ORI LAB Ends Remedy 5.07 Fl. Oz. True nakhair/nakhairorilabendsremedy5oz.jpg Bonus Deal Available 19.95 19.95 15.96 True True Valid Thru 08/31/26 False False 15.96 False False Diversion contract is required NAK Hair ORI LAB Ends Remedy is a superior leave-in moisturizer designed to smooth, detangle and hydrate fragile hair strands and provide protection from heat and UV factors. True Log in to view pricing! False

ORI LAB
Ends Remedy

Promotional ItemLog in to view pricing!
View Sizes
179945 ORL-03-MM5 ORL-03-MM5 1 Moisture Mist 5.07 Fl. Oz. ORI LAB ORI LAB Moisture Mist 5.07 Fl. Oz. False orilab/orilabnakhairmoisturemist150ml.jpg Bonus Deal Available 19.95 19.95 15.96 True True Valid Thru 08/31/26 False False 15.96 False False Diversion contract is required ORI LAB Moisture Mist is a hydrating formula designed to refresh, condition, and detangle hair strands. True Log in to view pricing! False

ORI LAB
Moisture Mist

5.07 Fl. Oz.

SKU ORL-03-MM5

Promotional ItemLog in to view pricing!
Quick View
146057 ORL-03-ODS3 ORL-03-ODS3 1 Overnight Dew Serum 3.52 Fl. Oz. ORI LAB ORI LAB Overnight Dew Serum 3.52 Fl. Oz. False nakhair/nakhairorilabovernightdewserum3oz.jpg Bonus Deal Available 19.95 19.95 15.96 True True Valid Thru 08/31/26 False False 15.96 False False Diversion contract is required NAK Hair ORI LAB Overnight Dew Serum is an opulent leave-in serum designed to deeply nourish and restore hair moisture while you sleep. True Log in to view pricing! False

ORI LAB
Overnight Dew Serum

3.52 Fl. Oz.

SKU ORL-03-ODS3

Promotional ItemLog in to view pricing!
Quick View
157855 SUR-03-BMB2 SUR-03-BMB2 1 MOISTURE BOND LEAVE-IN TREATMENT 2.3 Fl. Oz. Surface Hair Surface Hair BASSU MOISTURE BOND LEAVE-IN TREATMENT 2.3 Fl. Oz. False surfacehair/surfacebassumoisturebondleaveintreatment2.3floz.jpg Bonus Deal Available 22.00 22.00 17.60 True True Valid Thru 08/31/26 False False 17.60 False False Diversion contract is required Surface Hair BASSU MOISTURE BOND LEAVE-IN TREATMENT is a cream to oil leave-in treatment that brings bleached, dry, damaged hair back to life. True Log in to view pricing! False

Surface Hair
BASSU MOISTURE BOND LEAVE-IN TREATMENT

2.3 Fl. Oz.

SKU SUR-03-BMB2

Promotional ItemLog in to view pricing!
Quick View
157841 SUR-03-TRT6 SUR-03-TRT6 1 REPAIR TONIC 6 Fl. Oz. Surface Hair Surface Hair TRINITY COLOR CARE REPAIR TONIC 6 Fl. Oz. True surfacehair/surfacetrinitycolorcarerepairtonic6floz.jpg Bonus Deal Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required Surface Hair TRINITY COLOR CARE REPAIR TONIC penetrates the hair for color retention, repair, shine, and conditioning. True Log in to view pricing! False

Surface Hair
TRINITY COLOR CARE REPAIR TONIC

Promotional ItemLog in to view pricing!
View Sizes
162324 TRS-03-NMP16 TRS-03-NMP16 1 Stop Damage No Metal Protect Fluid 16.9 Fl. Oz. Truss Truss Professional Backbar Essentials Stop Damage No Metal Protect Fluid 16.9 Fl. Oz. False truss/trussstopdamagenometalprotectfluid16.9floz.jpg Bonus Deal Available 68.00 68.00 61.20 True True Valid Thru 08/31/26 False False 61.20 False False Diversion contract is required Truss Stop Damage No Metal Protect Fluid removes heavy metals from hair, maintains hair color, and replenishes that repair and strengthen the hair fiber before or after chemical processes. True Log in to view pricing! False

Truss
Professional Backbar Essentials Stop Damage No Metal Protect Fluid

16.9 Fl. Oz.

SKU TRS-03-NMP16

Promotional ItemLog in to view pricing!
Quick View
155360 SUR-03-AM4 SUR-03-AM4 1 MIST 4 Fl. Oz. Surface Hair Surface Hair AWAKEN MIST 4 Fl. Oz. False surfacehairhealthart/surfaceawakenmist4oz.jpg Bonus Deal Available 18.00 18.00 18.00 False True Valid Thru 07/31/26 False False 0.00 False False Diversion contract is required Surface Hair AWAKEN MIST is a leave in conditioner and detangler that uses natural botanicals to soothe fragile hair, Natural Capsicum and Menthol to stimulate, and vegan Amaranth, Soy, and Keravis protein blend to strengthen and support healthy hair. True Log in to view pricing! False

Surface Hair
AWAKEN MIST

4 Fl. Oz.

SKU SUR-03-AM4

Promotional ItemLog in to view pricing!
Quick View
142229 VTU-03-HOL1 VTU-03-HOL1 1 HEALING OIL 1.7 Fl. Oz. VIRTUE VIRTUE HEALING OIL 1.7 Fl. Oz. True virtue/virtuehealingoil.jpg Bonus Deal Available 23.00 23.00 23.00 False True Valid Thru 08/31/26 False False 0.00 False False Diversion contract is required Virtue® HEALING OIL is a unique blend of pure, hydrating super oils and our hair-healing Alpha Keratin 60ku® in one bottle. True Log in to view pricing! False

VIRTUE
HEALING OIL

Promotional ItemLog in to view pricing!
View Sizes
142232 VTU-03-NHO1 VTU-03-NHO1 1 HEALING OIL NFS 1.7 Fl. Oz. VIRTUE VIRTUE HEALING OIL NFS 1.7 Fl. Oz. False virtue/virtuehealingoil.jpg Bonus Deal Available 19.20 19.20 19.20 False True Valid Thru 08/31/26 False False 0.00 False False Diversion contract is required Virtue® HEALING OIL is a unique blend of pure, hydrating super oils and our hair-healing Alpha Keratin 60ku® in one bottle. True Log in to view pricing! False

VIRTUE
HEALING OIL NFS

1.7 Fl. Oz.

SKU VTU-03-NHO1

Promotional ItemLog in to view pricing!
Quick View
137682 LSD-03-LTO1 LSD-03-LTO1 1 The Oil 1.69 Fl. Oz. Alfaparf Milano Alfaparf Milano Lisse Design Keratin Therapy The Oil 1.69 Fl. Oz. False alfaparfmilano/alfaparfmilanoktldtheoil1oz.jpg Bonus Deal Available 24.87 24.87 14.92 True False False False 14.92 False False Diversion contract is required Alfaparf Milano Lisse Design Keratin Therapy The Oil is an elixir in oil silk effect, specific for after the smoothing service. True Log in to view pricing! False

Alfaparf Milano
Lisse Design Keratin Therapy The Oil

1.69 Fl. Oz.

SKU LSD-03-LTO1

On SaleLog in to view pricing!
Quick View
130165 WEL-03-ERLI5 WEL-03-ERLI5 1 Renewing Leave-in Spray 5.07 Fl. Oz. Wella Wella Professionals Elements Renewing Leave-in Spray 5.07 Fl. Oz. False wella/wellaelementrenewleaveinspray.jpg Bonus Deal Available 14.70 14.70 11.76 True False False False 11.76 False False Diversion contract is required Wella ELEMENTS Renewing Leave-in Spray is de-stressing and detangling spray that protects hair from daily mechanical stress (combing or heating tools) and breakage, while it hydrates and tames static or frizzy hair. True Log in to view pricing! False

Wella
Professionals Elements Renewing Leave-in Spray

5.07 Fl. Oz.

SKU WEL-03-ERLI5

On SaleLog in to view pricing!
Quick View