deva curl

Summer Savings, New Finds: July/August Promos Just Landed |

Fresh Arrivals, Big Deals—Log In to Unlock Our July/August Magazine!

Keyword Search Results

(376 Items)

109473 DEV-02-CB32 DEV-02-CB32 1 CURLBOND Re-Coiling Mild Lather Cleanser Liter DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser Liter True devacurl/devagscurlbondcleanser32oz.jpg Bonus Deal Available 31.00 31.00 24.80 True True Valid Thru 08/31/25 False False 24.80 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False

DevaCurl
CURLBOND Re-Coiling Mild Lather Cleanser

Promotional ItemLog in to view pricing!
View Sizes
109733 DEV-12-LDG32 DEV-12-LDG32 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter True devacurl/devacurlnewpackagingdevagslightdefininggel32oz.jpg Bonus Deal Available 29.00 29.00 23.20 True True Valid Thru 08/31/25 False False 23.20 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109765 DEV-12-UDG32 DEV-12-UDG32 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter True devacurl/devacurlnewpackagingdevagsultradefininggel32oz.jpg Bonus Deal Available 29.00 29.00 23.20 True True Valid Thru 08/31/25 False False 23.20 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. False Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109530 DEV-02-NP32 DEV-02-NP32 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture Liter DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture Liter True devacurl/devagsnopoooriginal32oz.jpg Bonus Deal Available 29.00 29.00 23.20 True True Valid Thru 08/31/25 False False 23.20 False False Diversion contract is required DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False

DevaCurl
NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

Promotional ItemLog in to view pricing!
View Sizes
109579 DEV-03-CB32 DEV-03-CB32 1 CURLBOND Re-Coiling Cream Conditioner Liter DevaCurl DevaCurl CURLBOND Re-Coiling Cream Conditioner Liter True devacurl/devagscurlbondconditioner32oz.jpg Bonus Deal Available 31.00 31.00 24.80 True True Valid Thru 08/31/25 False False 24.80 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Cream Conditioner with Patented CurlBond Complex re-coils damaged curls, softens, detangles, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False

DevaCurl
CURLBOND Re-Coiling Cream Conditioner

Promotional ItemLog in to view pricing!
View Sizes
109636 DEV-03-OC32 DEV-03-OC32 1 ONE CONDITION ORIGINAL Rich Cream Conditioner Liter DevaCurl DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner Liter True devacurl/devagsoneconditionoriginal32oz.jpg Bonus Deal Available 29.00 29.00 23.20 True True Valid Thru 08/31/25 False False 23.20 False False Diversion contract is required DevaCurl ONE CONDITION ORIGINAL Rich Creamy Conditioner is designed for dry, medium to Coarse Curls with olive oil and nourishing botanicals. True Log in to view pricing! False

DevaCurl
ONE CONDITION ORIGINAL Rich Cream Conditioner

Promotional ItemLog in to view pricing!
View Sizes
109484 DEV-02-DNP32 DEV-02-DNP32 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture Liter DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture Liter True devacurl/devagsnopoodecadence32oz.jpg Bonus Deal Available 29.00 29.00 23.20 True True Valid Thru 08/31/25 False False 23.20 False False Diversion contract is required DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. False Log in to view pricing! False

DevaCurl
NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

Promotional ItemLog in to view pricing!
View Sizes
109603 DEV-03-DOC32 DEV-03-DOC32 1 ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner Liter DevaCurl DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner Liter True devacurl/devagsoneconditiondecadence32oz.jpg Bonus Deal Available 29.00 29.00 23.20 True True Valid Thru 08/31/25 False False 23.20 False False Diversion contract is required DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner designed for dry, coarse curls. True Log in to view pricing! False

DevaCurl
ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner

Promotional ItemLog in to view pricing!
View Sizes
109582 DEV-03-CBB32 DEV-03-CBB32 1 CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter DevaCurl DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter False devacurl/devacurlcurlbondproboost.jpg Bonus Deal Available 84.00 84.00 67.20 True True Valid Thru 08/31/25 False False 67.20 False False Diversion contract is required DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment tames frizz for up to 50 washes and maintains the integrity of hair after a color service. True Log in to view pricing! False

DevaCurl
CURLBOND PRO BOOST Re-Coiling In-Salon Treatment

Liter

SKU DEV-03-CBB32

Promotional ItemLog in to view pricing!
Quick View
97711 DEV-10-TWIST DEV-10-TWIST 1 DevaTwist DevaCurl DevaCurl DevaTwist False devacurl/devacurldevatwisttowel.jpg Bonus Deal Available 15.50 15.50 15.50 False False False False 0.00 False False Diversion contract is required Share the hands-free, frizz-fighting, multitasking way to dry curls with your clients with the DevaTwist. True Log in to view pricing! False

DevaCurl
DevaTwist

SKU DEV-10-TWIST

Log in to view pricing!
Quick View
109742 DEV-12-PP16 DEV-12-PP16 1 PLUMPING PRIMER Body-Building Gelée 16 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 16 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer16oz.jpg Bonus Deal Available 25.00 25.00 25.00 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Log in to view pricing!
View Sizes
109748 DEV-12-SCR3 DEV-12-SCR3 1 SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupercream3oz.jpg Bonus Deal Available 9.00 9.00 9.00 False False False False 0.00 False False Diversion contract is required DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

Log in to view pricing!
View Sizes
109769 DEV-12-WM3 DEV-12-WM3 1 WAVE MAKER Lightweight Moisturizing Definer 3 Fl. Oz. DevaCurl DevaCurl WAVE MAKER Lightweight Moisturizing Definer 3 Fl. Oz. True devacurl/devacurlnewpackagingdevagswavemaker3oz.jpg Bonus Deal Available 9.00 9.00 9.00 False False False False 0.00 False False Diversion contract is required DevaCurl WAVE MAKER Lightweight Moisturizing Definer is a lightweight cream with a hydra-definition blend that provides fine curls with shape and frizz control. True Log in to view pricing! False

DevaCurl
WAVE MAKER Lightweight Moisturizing Definer

Log in to view pricing!
View Sizes
142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 20.00 20.00 20.00 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. False Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Log in to view pricing!
View Sizes
21928 DEV-10-DTOW DEV-10-DTOW 1 DevaTowel 20 inch x 39 inch DevaCurl DevaCurl DevaTowel 20 inch x 39 inch False devacurl/devacurl_devatowel_group_b.jpg Bonus Deal Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required DevaCurl DevaTowel is a smooth, microfiber texture towel that helps absorb excess moisture and enhances curl shape without roughing them up so your curls dry with more definition and less frizz. True Log in to view pricing! False

DevaCurl
DevaTowel

20 inch x 39 inch

SKU DEV-10-DTOW

Log in to view pricing!
Quick View